DPCstruct | MC44742
Metacluster Properties and Pfam Annotations
| Number of structural domains | 96 |
|---|---|
| Mean domain length (aa) | 171 ± 30 aa |
| Standard deviation of domain lengths | 30.33 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 87.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 28.40 |
| Pfam Score | 99.09 |
| Assigned Pfam label(s) | CL0023- PF08393 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A086LGI8 | 221-402 | MTFARFCFISDDELLSVLGSSSPAGVQPLMLKLFDNCKQLILEADTQVLGMVSEEGEVLQFHEPVAAEGPAEDWVKNVDEAMKRSLH… |
| A0A4W3HWD1 | 1-106 | MVEKWLLQVEGMMLDSVKHVLQQGVGNYVQVHRKKWVLHWPGQVVICVSTIYWTSEVSEAIRDGKLTDYLKKSNEQISDIVELVRGK… |
| A0A151HM61 | 585-773 | None |
| A0A7R9ASN9 | 36-209 | None |
| A0A7R9AQ82 | 8-299 | None |
| T1L4C9 | 378-563 | None |
| A0A820U185 | 531-670 | None |
| A0A812K4G7 | 261-386 | None |
| A0A086K724 | 244-425 | None |
| A0A086JIU8 | 79-262 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.