DPCstruct | MC4474
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 211 ± 17 aa |
| Standard deviation of domain lengths | 16.51 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 34.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B7H4M2 | 3-218 | MRLCETESQALKANLGHLLSPEVSSSLMWFLRRFCLSYLSPDESFYTEASSFCSIPLSSSSLPHPLSVALTSAFGRDSEGAAWTLNY… |
| H2ZC65 | 446-645 | VLRVSEIETESLKTGMIGLLSPQLSEDILWFLRIWAATYLLYKEEYYKELSPVLSCAFGRDSDGSKWLIRHLVIKIMTSLTHWGSET… |
| A0A6B0R096 | 363-563 | None |
| A0A287F9C0 | 227-467 | None |
| S9X9K1 | 199-420 | None |
| A0A2P2MR29 | 182-386 | None |
| A0A6A3B9Q1 | 28-237 | None |
| A0A7R9CKL7 | 2-202 | None |
| A0A452YFL0 | 26-236 | None |
| A0A452YFI7 | 117-358 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.