DPCstruct | MC44738
Metacluster Properties and Pfam Annotations
| Number of structural domains | 110 |
|---|---|
| Mean domain length (aa) | 156 ± 23 aa |
| Standard deviation of domain lengths | 23.43 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 23.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06541 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D1R890 | 2-136 | LARFLIYGALGWCLEVLFTGVSAVVFKRDRAATGKTYLWMFPIYGATALLLERLHDAMSAPLPVRALVYVLVIYLAELSAGWTLRRL… |
| A0A373JBT1 | 9-138 | LRILWKYLCIFWFCGLTYALMEILVRGRSAYEMVILAGICGVICLAPFNNFTSYNTDFLFQSISCGTICTFLEWICGVFFNKNHQIW… |
| A0A3E3E8K1 | 236-397 | None |
| A0A511SSV0 | 7-173 | None |
| A0A316NX79 | 75-282 | None |
| A0A7X7KRP2 | 33-223 | None |
| C6LJC5 | 38-225 | None |
| A0A1G9X8I7 | 3-130 | None |
| A0A3A5A317 | 3-167 | None |
| A0A3C0BKQ0 | 22-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.