DPCstruct | MC44732
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 114 ± 14 aa |
| Standard deviation of domain lengths | 13.59 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 32.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00277 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F2IUK9 | 43-147 | FFEQFEAGTKDMVRNYKDMKDAKTIGSDKYFHCKANCEASRRGTGGKAASYVISGGREVYGHYKGEPITDTFDDLVANEVGRRGDSN… |
| A0A226F2N0 | 4-112 | RAFVIIFLVWMMATLALSQNPCSAGKMWTNYNAMKAANCRNCDKYFHCQGNYEAVRNCRGILQVATATAISNLREWAQGNDTPDSAA… |
| A0A2I3TSR3 | 2-109 | None |
| A0A3Q7SNL9 | 308-421 | None |
| A0A147BEG1 | 23-149 | None |
| A0A4W2IGQ1 | 58-173 | None |
| A0A8B3SP38 | 43-146 | None |
| A0A140CZM4 | 110-233 | None |
| T1KHI0 | 44-167 | None |
| A0A443SQ79 | 17-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.