DPCstruct | MC4473
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 107 ± 16 aa |
| Standard deviation of domain lengths | 15.71 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 89.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 49.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02898 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W4Q223 | 138-230 | DTTRDSTLWKDRALVELNAAVLHSFKKAGVSIVDHHTAAKQFKQFEEREKGQGRKLTGTWSWLIPPMSSAATHIFHKDYEDEIMKPN… |
| A0A5B7H322 | 7-102 | MGLDTSTNESLWKDEVNVEVNKAVLHSFQAAGVTLVDHHTASQSFIQFLANEQRDRGGCPADWVWIVPPISGSLTPVFHQEMSLYYL… |
| F7DLC7 | 377-491 | None |
| A0A2C9JBG8 | 1-97 | None |
| A0A2C9K406 | 255-371 | None |
| A0A6P4EAF3 | 83-206 | None |
| A0A352AP46 | 578-686 | None |
| A0A1T3NPD6 | 289-382 | None |
| A0A7R8XD72 | 98-192 | None |
| A0A1S3IG29 | 247-341 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.