DPCstruct | MC44729
Metacluster Properties and Pfam Annotations
| Number of structural domains | 115 |
|---|---|
| Mean domain length (aa) | 192 ± 27 aa |
| Standard deviation of domain lengths | 27.40 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 68.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 28.03 |
| Pfam Score | 89.49 |
| Assigned Pfam label(s) | PF00010- PF07527 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A226EKW0 | 1-191 | MAPLTEISRSFGQQSPAEPISRTMQYRKITKPLLERQRRARMNRCLDELKEIMVSSENMTDKFSKSIEKADVLELSLKYIQTLQQQH… |
| A0A1V4K422 | 1-136 | MTAAASASSTHKLASTKEERKLRKPLIERKRRERINNCLDQLKETVVGAFHLDQSKLEKADILEMTVKHLQNIQSSKMMADSKVGLE… |
| E9GEU4 | 32-212 | None |
| A0A2B4SKR2 | 1-205 | None |
| A0A182FTU2 | 4-219 | None |
| T1DPF5 | 12-210 | None |
| A0A7R8XFW8 | 2-226 | None |
| A0A034V0E6 | 1-169 | None |
| A0A671U2N0 | 21-169 | None |
| H3BCL5 | 3-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.