DPCstruct | MC44727
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 487 ± 70 aa |
| Standard deviation of domain lengths | 70.17 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 75.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 22.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0108 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Y9D9R7 | 397-833 | SSQGCVDHPIVLTEAVCNPLYSRQMMSELLFECYGIPKVAYGIDSLFSFYHNQPKNLISSGLIISSGYQCTHILPILEGRLDAKNCK… |
| A0A6A7G0M1 | 42-522 | INIGQHTIHVIPVLDGGAVTNKSRRIKIGGHSMTKFLYRWLQLQYSQHSNSITLSRAEELIHNRIRIACEFQAELSEWTDTEYYEKN… |
| A0A061FL51 | 135-712 | None |
| H0EVP6 | 28-526 | None |
| A0A177VXW7 | 239-768 | None |
| A0A1W0E5X5 | 1-467 | None |
| A0A2P8XRA2 | 2-428 | None |
| A0A8A3P9N5 | 100-515 | None |
| A0A0A8Z5M5 | 2-401 | None |
| E3RFG8 | 39-546 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.