DPCstruct | MC44725
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 134 ± 21 aa |
| Standard deviation of domain lengths | 21.42 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 89.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 20.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G9IH12 | 36-173 | EFTSNGLLPQGIHWATLDDIKEKLSFSTKRRTLIAGLELALKSFKIAGCEKMYIDGSFVTSKNEPSDIDACWDISNVDPTKLDPILL… |
| A0A0J8STN0 | 28-167 | LTPGIHKISLNKLEETLLVPFEDKRTRTYLCNRFRVLFEELKSYKVEMIIWIDGSICSIKPHPSDIDMVIFLNENDLSDLPSNLYDK… |
| A0A7D8YLN8 | 20-155 | None |
| A0A517YLQ2 | 6-120 | None |
| A0A7I9YGS0 | 7-179 | None |
| A0A7G9KSW1 | 36-194 | None |
| A0A5C7XNU5 | 49-189 | None |
| A0A1I3IL06 | 3-122 | None |
| A0A1W9JL26 | 34-173 | None |
| A0A7H0V9V9 | 2-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.