DPCstruct | MC44721
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 65 ± 9 aa |
| Standard deviation of domain lengths | 8.61 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 41.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16366 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R3UPU1 | 11-71 | VKPYVLDNQMCDECQGARCGGKFAPLFCANVTCLQYYCEQCWIQIHSRQGREYHKPLVKEG |
| A0A3P7DJD0 | 146-210 | PYVIDEQMCDECEGTQCAGRYAPYFCGDVTCLQYYCESCWDCYHYGEYSDKKKASHKPLVRVGDQ |
| A0A6J1WMY3 | 32-88 | None |
| A0A814WB28 | 608-680 | None |
| G0PH82 | 351-422 | None |
| A0A818YJ71 | 543-606 | None |
| A0A669DHB3 | 434-490 | None |
| H9GIH4 | 436-499 | None |
| A0A0M3IT75 | 149-209 | None |
| A0A0M3IVH9 | 77-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.