DPCstruct | MC4472
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 186 ± 11 aa |
| Standard deviation of domain lengths | 11.26 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 41.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B7H1B4 | 1-195 | MHGNTITLALHYSFSFHQDRSDRTILTPWVKFLWESYRQCLELLRTNSRVERLYHDIAKQAFKFCEKYSRKTEFRKLCDNLRTHLSH… |
| A0A2R7VX72 | 1-182 | MNAVSGEDAQDRSDRTILTPWVKFLWESYCQCLELLRTNAHCETLYHDIARMAFNFCLKYNRKTEFRKLCDKLRKHLEDISKLPVQV… |
| A0A0C2M876 | 128-309 | None |
| A0A6A3ANZ1 | 129-311 | None |
| A0A812R9Y6 | 6-212 | None |
| M2X303 | 164-331 | None |
| A0A2H1BYC7 | 90-276 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.