DPCstruct | MC44718
Metacluster Properties and Pfam Annotations
| Number of structural domains | 255 |
|---|---|
| Mean domain length (aa) | 161 ± 32 aa |
| Standard deviation of domain lengths | 32.20 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 85.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 32.45 |
| Pfam Score | 99.70 |
| Assigned Pfam label(s) | CL0426- CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R3UFS4 | 291-465 | MDALQAFWPGLQTINGDVNAAVAHHEMLFMVHQRHGLLPEAFTTDMDIYWPYHLIRPELVESTYLLYRSTGDSYYLHVGAELLSSIE… |
| A0A2U1KGF3 | 67-206 | GPWYHEADMRTGRATYWQLTSLQAFWPGLQVLAGDVAAANLTHREFFYVCKKFGVLPERYLLDHQMVHPTEKYYPLRPELAESTYYL… |
| A0A7S4S371 | 354-512 | None |
| A0A446Q1J9 | 136-284 | None |
| A0A316ZM04 | 239-406 | None |
| A0A3Q0IWM0 | 40-181 | None |
| A0A553MWV9 | 1-110 | None |
| A0A2C9K3P4 | 93-268 | None |
| A0A6V8H9S4 | 742-923 | None |
| A0A6P6BSQ7 | 248-413 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.