DPCstruct | MC44717
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 160 ± 28 aa |
| Standard deviation of domain lengths | 27.69 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 65.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 37.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R3UF78 | 5-177 | PSGQSNPTNRPPTTSSSHPVSGNEADGVWSTEIEQYFQEALELYPPCGRRKIILAEEGKMYGRNELIARYIQQRTGKVRTRKQVSSH… |
| A0A3N4I5E7 | 80-196 | VWDDELEEAFHEAIRTIPIIGKTKLQLNGKQCGRNELISDYIYRTTGRLRTRKQISSHIQVLKHLLSNDAEFIKFVNNSKPVERKQK… |
| A0A183SI79 | 116-323 | None |
| I7ZY33 | 54-181 | None |
| A0A5M3N1F8 | 1-164 | None |
| A0A1G4JU98 | 109-337 | None |
| A0A6A4WL29 | 2-155 | None |
| A0A6S7H289 | 4-122 | None |
| A0A3P7FRZ4 | 27-172 | None |
| H0VJH5 | 17-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.