DPCstruct | MC44712
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 191 ± 38 aa |
| Standard deviation of domain lengths | 37.76 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 75.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 22.27 |
| Pfam Score | 94.18 |
| Assigned Pfam label(s) | CL0123- PF19675 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R3U822 | 115-309 | FAFQQLKSSPAKSPDTANTRKSSSSTWKSTLDGFFEWVCDALAPKASSGSHSLIPAPHTMPLHEVFYGPPSGELAALKQRIDPPLQR… |
| A0A6G0IF18 | 10-148 | SPPETQTLYEVCYYTSSATVRRHLNATPRTSIQAALSSPYYYLQNESLKTEDGTVSNAAPDICIAYKLHLECGRLINLYDWLEAYAT… |
| A0A2G8LLV3 | 151-410 | None |
| A0A3F2RK25 | 118-328 | None |
| C4JIE8 | 319-481 | None |
| A0A366S6A7 | 1068-1240 | None |
| A0A287HIQ9 | 1-122 | None |
| Q2HAC6 | 525-712 | None |
| A0A2H9TPG3 | 637-783 | None |
| A0A817BK53 | 507-720 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.