DPCstruct | MC44710
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 190 ± 21 aa |
| Standard deviation of domain lengths | 21.07 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 15.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6S5YR57 | 21-217 | QKIIKAKMGSNDISVAIPNEISLSLNISVKSLSIAEKKHEEIKSRASTNDTIFDADVRIAYDFLEEIQKAIIFSYKAVESFCNASIP… |
| A0A7W5ZVS7 | 7-196 | APVTGRDEFEREFMATLIEDAARALHRFASVGSVEIAAKDLQAARRDLVRNLHAAIEGAVWAFREHVRSTAKSLDVLSRHEEIALSE… |
| A0A849QQ32 | 210-386 | None |
| A0A7V6XJS3 | 55-241 | None |
| A0A1X3K4X8 | 5-164 | None |
| A0A2N6D180 | 35-208 | None |
| A0A6L5FWG5 | 12-232 | None |
| A0A7C3LFR7 | 33-221 | None |
| A0A2V9WV10 | 209-429 | None |
| A0A1F3K289 | 55-270 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.