DPCstruct | MC44702
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 139 ± 15 aa |
| Standard deviation of domain lengths | 15.00 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 27.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A452TL17 | 3-144 | MTPDQLMTLCTAGIHSSNTGVRVNVVSILGITGSVLAKEDGTLETLKTIGCFLLEVATKDPSLVVAGEALDALFDVFADGKEAERAS… |
| A0A5C6NP64 | 2-141 | TPQQLMSLSEAGTCCEVISVRVNAVAILGITGSTLAKEKGTAATLQMIGKALLQVATSDADLVVNGEALDALFDVFADGDEAETAAK… |
| A0A369RTF0 | 495-634 | None |
| D7FH07 | 662-804 | None |
| S4RYJ2 | 111-251 | None |
| W7TXM1 | 5-120 | None |
| A0A2P8Y5G9 | 345-485 | None |
| A0A812CX89 | 265-406 | None |
| A0A7S1UJA5 | 1-124 | None |
| A0A1S4EI28 | 42-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.