DPCstruct | MC4470
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 92 ± 11 aa |
| Standard deviation of domain lengths | 10.85 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 40.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A814S714 | 362-447 | DMNEPANFDTNANRPFNYPDHKPDWNLHCPKDEPLETPKYKTAILGQYLSDKTMCMIGEQTDGQGKIYKHYDVHNLYGWSETVASL |
| A0A5B7GMJ0 | 11-97 | MNEPANFGTNEKQPWNWPEGRQPWSLTCPNTTLEDPPYLPAAVTVWGPGKRLSDKTICMEAQQGEQRELTHYDVHNLYGWSQAQPTL |
| A0A0P4VSC2 | 105-195 | None |
| A0A0B2W2F9 | 156-244 | None |
| A0A0B2VUI1 | 200-291 | None |
| A0A820S5Z3 | 1-70 | None |
| A0A0B2V4I5 | 114-203 | None |
| A0A0M3ILY6 | 153-240 | None |
| A0A0M3IL07 | 44-133 | None |
| A0A368FQN4 | 1-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.