DPCstruct | MC447
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 89 ± 8 aa |
| Standard deviation of domain lengths | 7.65 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 31.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A355D9J5 | 1-83 | MNNEQKEKIKQMRKQGIGYKQIANEIGLSRDSVRGYCKREWDISHNKSYDLNCSYCGKEFKSLGVKHLKYCSRNCYIKDRFWR |
| A0A1Y3T118 | 5-97 | MTEQQLEQIAALRKENYPYSFIGRELGLSPNTVKSICQRKGFAASGARKTKAEKQNAPLCRYCHKPLPETKRRGALFCSDYCRTKWY… |
| A0A3R6JJT5 | 1-85 | None |
| A0A1M4X7W2 | 1-97 | None |
| A0A1Y3WFJ3 | 1-93 | None |
| R5BRE0 | 1-75 | None |
| A0A1M6L245 | 1-93 | None |
| A0A1V5GRC5 | 1-103 | None |
| A0A373Q0Q3 | 1-95 | None |
| R7GUV1 | 1-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.