DPCstruct | MC44699
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 105 ± 14 aa |
| Standard deviation of domain lengths | 14.18 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 73.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 56.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A384DLC1 | 27-124 | LRAAGVEQLMYIKEDLILPHYHTFYDFIVTKARGKSGPLFSFDVHDDVRLLSDATMEKDESHAGKVVLRSWYEKNKHIFPASRWEPY… |
| B6K6G2 | 156-262 | SIGRIIVSMKDQIPELRRVLNVDKFLFVMGDLIISHHHELYSFYINKSEGPNGLIFDFSLYTAKSAEETITQHLPNQYIPRLVEKTH… |
| A0A1I8IDC3 | 268-377 | None |
| A0A1I8FVA7 | 268-378 | None |
| M9LNT2 | 856-956 | None |
| A0A1X6PJR2 | 1-90 | None |
| A0A7S2V456 | 61-173 | None |
| A0A5J4V0A8 | 274-374 | None |
| A0A1B9HXW9 | 210-321 | None |
| D5ADV5 | 14-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.