DPCstruct | MC44698
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 541 ± 79 aa |
| Standard deviation of domain lengths | 78.58 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 27.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0513 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A5Y2J0 | 28-580 | TEIEDEEAQLLPRSEELDHEDPPNPTVRKRHHRPTGFWACFYGPDPPRIQSIKPWFPKIQQFPANAVDRWMPSRKRKLVALAALFFL… |
| A0A1Y1UTX4 | 39-482 | LLYPFLALWCMAFILLIRQQYYVGNIGVISCDAAVWADWPPDTCGIDGFACLDQLEEGTYRCLGGCQGVPLGNPRWVGGVSVDGIPL… |
| A0A6G1I4L5 | 78-623 | None |
| A0A6A5SXI7 | 16-590 | None |
| A0A7S3LS80 | 42-457 | None |
| A0A1J7IFW4 | 304-850 | None |
| A0A1E3NGP4 | 87-719 | None |
| A0A1C7MQ76 | 1-395 | None |
| A0A4S4M0Q6 | 496-1094 | None |
| S3DN95 | 155-768 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.