DPCstruct | MC44697
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 125 ± 11 aa |
| Standard deviation of domain lengths | 11.38 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 31.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M7M494 | 46-163 | MTHLDTLPPEILFNVLSYTEPDLNPTLSIPVLNALAATNKHLNAIVEEYARSLLLRHRNITPPKRPKKFTCRGKWLGEICAFCKGNS… |
| A0A6A5Y0Y6 | 1-139 | MSTLESLPPEILFNILSHLSPFNSRPLRGLHNHPLELLAQTSHRLSHITEDYARHLLLVHAKKTPRLRASGPKYRDIWFRWLLTTCQ… |
| A0A6A5WN31 | 1-122 | None |
| A0A6A6G0K4 | 1-147 | None |
| M2MZA6 | 8-132 | None |
| A0A5J5EUQ5 | 1-129 | None |
| A0A6A6JIH8 | 57-162 | None |
| A0A7C8I3G7 | 1-120 | None |
| A0A3N4LHP6 | 25-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.