DPCstruct | MC44694
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 62 ± 7 aa |
| Standard deviation of domain lengths | 6.80 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 50.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D9UIC6 | 1-70 | MTASTTGGGTPATCVTANNYAHVAAGRAHVSGGYAYTNGGNQNMGLYNVFITHTLRQTGPDSWELADGAC |
| A0A821EGJ2 | 125-178 | VCFNDNNFNHVTTGRAYHSLGYALATGSNQNMGLYNTFQKTNLCKIRENYYVIE |
| A0A7K3DRK9 | 250-307 | None |
| A0A1S6RZJ4 | 29-98 | None |
| A0A815N0E3 | 326-383 | None |
| A0A3A3GF97 | 233-298 | None |
| A0A814HH84 | 1065-1118 | None |
| A0A1K2HAI7 | 529-583 | None |
| A0A1C4KPB0 | 69-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.