DPCstruct | MC44692
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 128 ± 15 aa |
| Standard deviation of domain lengths | 14.93 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 23.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06386 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D9UGS9 | 1-145 | MTDAATAVCVFAVRRGRGPALPAGLTGHSDGGEVRLMAAGDLWAVVQEVPTAGYDDTALRARCADPAELERLARTHHAVVSAAAAEW… |
| A0A840IDB4 | 3-121 | EPAVGWYLYCVLDAAARPPLDGLVGVDGAAPIEPVDETGLRALASRVPLSEFGEEPLRRNLEDLAWVERTARAHDAVLARTLACDAV… |
| A0A6N7AKF3 | 4-139 | None |
| A0A147JSJ0 | 211-348 | None |
| A0A7J9X8A7 | 2-137 | None |
| A0A844IU45 | 4-144 | None |
| A0A1Q7N1F9 | 80-189 | None |
| A0A6N7APU0 | 165-281 | None |
| A0A4R9DZL4 | 2-122 | None |
| A0A291T242 | 2-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.