DPCstruct | MC4468
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 150 ± 15 aa |
| Standard deviation of domain lengths | 14.69 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 26.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E7UTK4 | 20-162 | EPLPEVRVERAATAVLGGFALANLSSGTAGYFAAEAPTWQAFHGTNAAWNTVNLGLAAAGAVSLSRRPVETLEERTTRGKRLHRLLA… |
| A0A2E7CTL5 | 17-166 | TAQDSLRIHNDFYKTQENAMKILGGWSAINIASSPFLKTTSTESWSHFHQMNFNWNLVNISIAGFGYMGLKKRKEKYWSLNSLEMDR… |
| A0A2E0TK68 | 3-161 | None |
| A0A2E0TLB8 | 26-215 | None |
| A0A7C3DJ18 | 33-174 | None |
| A0A3C1KZQ0 | 41-192 | None |
| A0A2E7CIQ8 | 16-154 | None |
| A0A4P5V1G4 | 2-133 | None |
| A0A651HS87 | 58-224 | None |
| A0A418M274 | 3-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.