DPCstruct | MC44678
Metacluster Properties and Pfam Annotations
| Number of structural domains | 194 |
|---|---|
| Mean domain length (aa) | 83 ± 12 aa |
| Standard deviation of domain lengths | 12.24 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 30.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02467 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y3KHA1 | 4-84 | WEWQFEGACRQADPDLFFHPEGERGSARRRRAEAAKAVCATCPVLEQCREQSLAVREPYGVWGGLSEDERAALLAQRARTV |
| A0A1F2F8B7 | 26-103 | DSFRDRQEWVTRAKCRDIDPDELFVRGAAQRQAAVICRHCPVVLQCRADALDNRVEFGVWGGLTERQRRAMLREHPEV |
| A0A7X6RIG1 | 3-84 | None |
| A0A285DXL7 | 4-92 | None |
| A0A1R0KD16 | 2-63 | None |
| A0A221QAB2 | 3-114 | None |
| A0A832B444 | 34-102 | None |
| A0A810LS45 | 16-93 | None |
| A0A1T3P4X7 | 18-109 | None |
| S3ZTW5 | 1-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.