DPCstruct | MC4467
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 210 ± 40 aa |
| Standard deviation of domain lengths | 40.02 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 65.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 21.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J5IG32 | 2-245 | ERVSTLIKKLQKQLDEKASAQMLLHTVQMLQAELQSQTVTKKEVSQNKAAVIMPVAYSTFRQEISAGNFSTAVSEEKVIEVLQVDEK… |
| A0A2E7CSB5 | 10-217 | EDLVKSLEKGLKKIKKGKISTDEMNLLLGDARFLHERISIIQYLFLKQSDQKENIVVNPSNDKKKKQISSEKIEDDEKNQINLLDAI… |
| R6WTR0 | 5-215 | None |
| A0A2E5YZB7 | 20-183 | None |
| A0A3B9SKB1 | 79-218 | None |
| A0A3D6CM02 | 72-295 | None |
| L1P7M8 | 378-606 | None |
| A0A4R0ZVX6 | 253-409 | None |
| A0A174BH86 | 279-509 | None |
| A0A291QTU9 | 13-282 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.