DPCstruct | MC44662
Metacluster Properties and Pfam Annotations
| Number of structural domains | 67 |
|---|---|
| Mean domain length (aa) | 64 ± 10 aa |
| Standard deviation of domain lengths | 9.93 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 37.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06945 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E6Q8D9 | 33-106 | SDSSGGPKYAVSARGPAPSPCIGVCHIDGSSGFCLGCFRTLPEIAQWHKKSDDERWAIIDEAEEREELAEEAEE |
| A0A1X4J0I3 | 12-58 | MASPCISICAIHPVTRMCTGCKRSREEIALWTRYSDEERAAIMRALP |
| A0A011UZX6 | 1-62 | None |
| A0A2A2UQT8 | 2-69 | None |
| A0A520NC99 | 3-64 | None |
| A0A371BHE9 | 4-59 | None |
| A0A0P9YSF7 | 178-256 | None |
| A0A1H3YT54 | 1-59 | None |
| A0A2G6EHI1 | 2-58 | None |
| A0A7I8EFY0 | 1-59 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.