DPCstruct | MC4466
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 181 ± 26 aa |
| Standard deviation of domain lengths | 25.58 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 21.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z4LQ20 | 64-221 | RSSCIAIVLPVSVIVNGTPLVVEKEDDFQIIQDIYDENDDDDDTLIIDFPIRVILPDFKSRSVGSENSLENLIRNCERDDFENENID… |
| A0A2E7CCE8 | 13-159 | YPLTFEVSDGSTLKVDNHRAMIKYKSSWKQNTESPNLKFPIKVKWTGKDPMIVESQEILDRHMDRCKKYQVAQKENCFEFIYPLAFE… |
| A0A5S5C3F7 | 44-209 | None |
| F4KZI5 | 51-212 | None |
| A0A0C1VJI2 | 153-312 | None |
| A0A5B1B727 | 1-145 | None |
| A0A1J5L288 | 27-233 | None |
| A0A7Y2J2D9 | 58-233 | None |
| A0A1X7INL6 | 4-211 | None |
| A0A2K1DZI5 | 23-229 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.