DPCstruct | MC44655
Metacluster Properties and Pfam Annotations
| Number of structural domains | 119 |
|---|---|
| Mean domain length (aa) | 178 ± 25 aa |
| Standard deviation of domain lengths | 25.07 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 23.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V1DQ76 | 18-181 | FVQIISWNDYGERQELHDFYGRLVLLPSQTEGVTAWYRPNPAAACSDGGTTGNTATHLQKEFLPHEIVKDKVFYSALLGEDAVVTVF… |
| A0A1C7LWA1 | 5-131 | FATAFKTGSAPAITQDKIYLWARPHPKDADSPDPVGKPTDFILTQDTLWALVFATSDATVTLATSNTTSQTFNVTAGVNKLSLPLTP… |
| A0A7H1N331 | 47-246 | None |
| A0A2S4KPU6 | 7-169 | None |
| A0A2V5IS39 | 259-458 | None |
| A0A3D8QA89 | 18-174 | None |
| A0A3D8T2Y4 | 254-447 | None |
| A0A3A8IJV7 | 29-193 | None |
| A0A146IA29 | 248-435 | None |
| K5W2N1 | 164-335 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.