DPCstruct | MC44652
Metacluster Properties and Pfam Annotations
| Number of structural domains | 75 |
|---|---|
| Mean domain length (aa) | 411 ± 100 aa |
| Standard deviation of domain lengths | 99.56 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 77.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 14.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V1DL12 | 67-438 | ENSPRGAHQTAYLTPSHSSDPRALNTASQVAEAISPYESALWAKPLRMQMKWITRQHVVLSVRYAALSEDSPYISLKCSHFEPEDSD… |
| A0A2T2NEL5 | 518-956 | ERQPKQKVSRRKGALQPQTREKASRMRKGGNTCVRCRFYKAGCDEGEPCQKCLKVANNARSFREPCSRDRIEDASLVRRCNGRFNQE… |
| W9NCX1 | 48-432 | None |
| A0A2J6TTA7 | 15-351 | None |
| A0A094KMV6 | 47-528 | None |
| A0A507BIQ1 | 99-533 | None |
| A0A4Z0Z122 | 38-343 | None |
| G0RRG1 | 2-465 | None |
| A0A420PFC6 | 5-321 | None |
| A0A6A6SI52 | 611-1037 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.