DPCstruct | MC44649
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 179 ± 17 aa |
| Standard deviation of domain lengths | 17.09 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 69.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 29.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V1D6R4 | 1-151 | MDSNIPAFLLERLSKAITNRRRYFAYWQKHTLKLSRTRDEPPGLQKNLTASREPRFQGFEAKSTVISYATTAKDVKGKPADLPPLPV… |
| A0A6C1M1Z8 | 1-171 | MSSADNETSFYETYDTMHVREKFPDASQFLVYRLGRAISWRRQYLKYRESHHKKLSHGIHPDHDAEQDSLTEIARQNDACSETASSF… |
| A0A3D8R4Y9 | 44-200 | None |
| A0A4Q4TWR3 | 163-343 | None |
| A0A132B5Q3 | 230-398 | None |
| A0A0U5GF87 | 155-351 | None |
| A0A1U8QGZ3 | 137-341 | None |
| A0A2B7XJJ3 | 210-384 | None |
| A0A1Y1Z6R1 | 1-201 | None |
| A0A1C1CT81 | 144-336 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.