DPCstruct | MC44648
Metacluster Properties and Pfam Annotations
| Number of structural domains | 99 |
|---|---|
| Mean domain length (aa) | 307 ± 60 aa |
| Standard deviation of domain lengths | 60.36 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 80.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 16.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V1D3U1 | 19-317 | AADPQFYSKDRTYVDIAKTITSEDYAYPHDSVPDEFEAETFLWKRCCLESYARTRVKLLEDGKRTRGSPRVATCPWATMRDTMGQTL… |
| A0A4S8KJZ8 | 258-509 | AAKHALDEFMKLAQVDMLSGLWWVDVALEFHSSDEQCLQWSTAGHFRVVRTLLEISDQNAERITTLGSSKYSKDLSSHLTQVSGCRI… |
| A0A2T6ZA87 | 595-886 | None |
| A0A6A5S586 | 34-293 | None |
| A0A0J9WCR7 | 20-326 | None |
| A0A6S6VZ61 | 171-518 | None |
| A0A0J9W9Q0 | 133-390 | None |
| A0A0J9VY67 | 109-477 | None |
| A0A0C2YJK3 | 508-690 | None |
| A0A366S461 | 242-583 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.