DPCstruct | MC44646
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 234 ± 28 aa |
| Standard deviation of domain lengths | 28.46 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 76.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.58 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 29.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6U209 | 73-314 | FDYDRTKMRDPRPSPGRVNRPRRGNWDMTEEFRSQFYVPIPTDPPGQLEPPQEGLSEHQQAQLKSRQQCERGRQTALLDPADDDYGI… |
| A0A2V1CXM9 | 1-234 | MPVDRRPSPGRIVNPRAANEEGAEPILSRGDPNEWPASDKHYSNRSYFHYTPQGEYVEDSDAPQGPPKKKGRYKNPERTKWEKDRYL… |
| V9DRN1 | 18-238 | None |
| A0A2P8A8G7 | 81-318 | None |
| N4UJV5 | 2-184 | None |
| U1HYI1 | 7-210 | None |
| A0A420TSG0 | 99-356 | None |
| A0A4V6YAS1 | 37-256 | None |
| S3D0D6 | 133-376 | None |
| A0A1J9SGR4 | 121-413 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.