DPCstruct | MC44643
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 99 ± 6 aa |
| Standard deviation of domain lengths | 6.17 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 25.99 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | PF02467- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A831UYM1 | 1-87 | LGGVEETMFIRVDGEEIKGEAETDVDRTTAEGKASSVHFIHFPFTDGQVEKFRRPDAEVVVGFKHPAYGHMALLSDGTRRALAEDFD |
| A0A6A5BW68 | 34-144 | MFEIDNEPIRKATLKKFGRIEYNFKLQICKKGSGELIVSLPCKPTEDGRTTNEGMTSAVHFFSVPFSKEQIQFLRDNLDNVQVKLTV… |
| A6G394 | 93-191 | None |
| A0A7V5T6E7 | 41-141 | None |
| A0A328ZZR5 | 552-654 | None |
| A0A2S9YK31 | 32-123 | None |
| A0A7C3U4U2 | 172-269 | None |
| A0A534PAG4 | 251-345 | None |
| A0A812QKL1 | 648-735 | None |
| A0A7V8W8C2 | 209-307 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.