DPCstruct | MC44638
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 221 ± 46 aa |
| Standard deviation of domain lengths | 46.07 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 80.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 25.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0248- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A239HDM1 | 178-390 | IGLEQLMAFTISDDFERQVQVFELLTESRSLAPHLIRQKLTENVVRAADKRARFVTPDAYVEAGGGIVRDLFEADGGGWLTDPALLD… |
| A0A840H2G3 | 1-220 | MTLEQLMAFAITYDQARQESVYGRLTHDRDASTIRRLLTETHIAAADRRARFVGLEAFIEAGGTILRDLFTDDRGGYLEDVALLDLL… |
| Q0FXP1 | 164-388 | None |
| A0A2R3Q4M4 | 530-780 | None |
| A0A246JU63 | 234-447 | None |
| A0A1V1V2S9 | 97-336 | None |
| B9NWU1 | 11-185 | None |
| A0A1P8QXZ6 | 2-148 | None |
| A0A1M3DP83 | 108-388 | None |
| A0A1L5P767 | 81-299 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.