DPCstruct | MC44636
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 87 ± 7 aa |
| Standard deviation of domain lengths | 6.71 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 35.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A242K6A1 | 2-84 | KKITITDMENGYVEQSNQFLCLYCAQSYHTSFVYPDNENLANAEFMIKKHLNSQHGGAAEALLQLDKNESGLTDIQKHFLSLV |
| U7V4Z6 | 9-89 | LKIEDISLGYVYNLKKQNFTCIFCGETFDEGIVYEDNHNFITAKRAIEQHIEREHNGVLKTLLSLEKDITGLTEIQSKVIT |
| A0A101I419 | 1-86 | None |
| W7C7W2 | 6-86 | None |
| A0A381KJC8 | 6-88 | None |
| A0A368W5P3 | 1-97 | None |
| A0A1I7IDB0 | 1-89 | None |
| A0A4R2QTL9 | 2-95 | None |
| A0A074LL13 | 2-77 | None |
| A0A3P6KQ44 | 4-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.