DPCstruct | MC44635
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 63 ± 3 aa |
| Standard deviation of domain lengths | 3.40 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 87.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 52.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X8Q5C9 | 1-55 | GIDILELEAAVRVLWREGIYAASGMGCTGPIIQVSDANLQKAKNILKESGYLATL |
| A0A645IAW6 | 2-63 | PAKKVVTYSIAGIDILELENACKALWKEDIYSESGMGCTGPIVLVAEEDSEKAMEILKKAEY |
| Q0AZK2 | 40-102 | None |
| A0A7V6GBM9 | 145-207 | None |
| A0A7X9GC04 | 1-72 | None |
| A0A356BZ86 | 587-650 | None |
| A0A847X3E4 | 84-146 | None |
| A0A353LYQ8 | 108-171 | None |
| A0A1G3R3Y2 | 806-868 | None |
| A0A8B0UCA0 | 318-381 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.