DPCstruct | MC44632
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 176 ± 22 aa |
| Standard deviation of domain lengths | 22.19 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 24.82 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | CL0123- CL0142 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X9CEZ4 | 2-166 | VLAFMVGPPATAYLITNDLRKMLILSPIFGILASISGYWIAVSLDVTIAGTMATMVGIIFTLVFVFLPDRGLIANSKREKTQKYDFA… |
| A0A2E1AKR4 | 305-494 | VVAFFIIPPAAAYLLTDRLSVMLVISAVIGSLGAFFGYDLARGHFLGIIEMDSVLALINRVFGLQLLEQWDSSISASMVLMIFIFFI… |
| A0A7W0GA54 | 134-306 | None |
| A0A6B1E6W3 | 51-273 | None |
| A0A7C6W526 | 22-197 | None |
| A0A831XUM6 | 98-306 | None |
| A0A7V5Q0D8 | 146-334 | None |
| A0A511R771 | 201-377 | None |
| A0A1H0IW95 | 1-166 | None |
| A0A353ZEW3 | 236-415 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.