DPCstruct | MC44627
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 174 ± 20 aa |
| Standard deviation of domain lengths | 20.23 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 22.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C6R8Q1 | 96-271 | PAVTIIIIASCIGLDQIGGDIVTQLKLYGFLDMIGTAVAAFLFGPWYGAAVGLGYNLLSAITSTPASAIFGLVNALGGLLWGFGARS… |
| A0A0D0FLF7 | 64-241 | AALVLIPIAIGINYIGKTIAAGLKLPLWLDSLGTILSSMLAGPIVGGLSGIINNIIYGITLDPVSTVYAITSGVIGIVVGALAYKGW… |
| D4KJA7 | 6-189 | None |
| A0A6B8VHZ7 | 68-228 | None |
| F4LPG3 | 2-146 | None |
| A0A3D2NFY6 | 118-300 | None |
| A0A1L8WTH7 | 2-144 | None |
| G0H4V7 | 1-149 | None |
| A0A536F0K9 | 225-393 | None |
| A0A7T4JE49 | 72-250 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.