DPCstruct | MC44623
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 91 ± 10 aa |
| Standard deviation of domain lengths | 9.66 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 43.17 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | CL0266- CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J0J9U6 | 5-82 | PEELCLRLAEAIGVGDEAVAAQSAAALARHHTELSVSLRDTNYPGGELSMAVWVEDATSSANITLRVRPHLTIGTLKE |
| A0A1V4KPY7 | 2-89 | TAQSLELAEKEELALRLAQAIEYGDEEAAARCAVALARQLATLRILWREDMYPSDEISMAVGVEDATSSASITLRVRAHTTIAELKEQ |
| A0A6J0E4E3 | 124-214 | None |
| A0A5C6NUE2 | 145-228 | None |
| A0A151N7T5 | 84-192 | None |
| A0A5C6N377 | 1-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.