DPCstruct | MC44616
Metacluster Properties and Pfam Annotations
| Number of structural domains | 921 |
|---|---|
| Mean domain length (aa) | 153 ± 28 aa |
| Standard deviation of domain lengths | 28.32 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 88.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 15.31 |
| Pfam Score | 93.51 |
| Assigned Pfam label(s) | PF17969- CL0187- CL0508- CL0244- PF18058 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A151ECL1 | 64-222 | ILEILTALNLNQGEYVFIINKEEQKAQLYKREYVLIDETRVSTGRNPGEKQRLGDNKTPSGVFEVTSLYDSTNWRFNGELAYGPKAV… |
| A0A0U0QP44 | 150-279 | GDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVH… |
| A0A4V6PJ58 | 136-277 | None |
| A0A1X1Q5K6 | 52-195 | None |
| A0A1W9JP37 | 282-466 | None |
| A0A417CAH7 | 397-585 | None |
| A0A6M0ETD4 | 14-143 | None |
| A0A416P490 | 469-602 | None |
| A0A370XCJ4 | 21-177 | None |
| A0A1Z8MSU6 | 176-362 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.