DPCstruct | MC44614
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 79 ± 9 aa |
| Standard deviation of domain lengths | 8.79 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 51.06 |
| Pfam Score | 95.00 |
| Assigned Pfam label(s) | PF07765- CL0366- PF08084 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B9GFN3 | 42-113 | VNHIYVNPEDIKVPDNGPWNHNFMGVKLTVSMKYGIKLGTPRDYYDEDHRPTHFLESSNLEEGETAREDTFT |
| G3AYA3 | 135-235 | YEWGKSNKDLLSMSPPGYSSAFSVKNQLVLSDRIVGSFMVPDDNIWNFAFLGQLWSAKNEFDLKVDIPLPYYHEFHRPIHFSQFNEI… |
| A0A815LHU2 | 1-94 | None |
| A0A540MCN5 | 405-478 | None |
| A0A3Q0JBQ9 | 731-805 | None |
| A0A7S0YUK7 | 1152-1223 | None |
| C9SPU1 | 55-144 | None |
| A0A7C9AJT4 | 24-103 | None |
| A0A2U1NIM5 | 208-286 | None |
| A0A2U1MB61 | 1-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.