DPCstruct | MC4461
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 145 ± 13 aa |
| Standard deviation of domain lengths | 12.59 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 46.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W4CRM8 | 19-161 | VVVPTPAAADVDVYTTEGTHNVNGRLWRTDCSMYSTTVERCRTEIQATTVTFSGSRYVEQRGWVFNNLTYKSSPRASWSFMNPLVTP… |
| A0A7W4CU26 | 2-137 | YTTPGNHLVNGRYWKTACDKYSDTVVRCRTEIWTTKVATVQGQHVLHNGWVFNNLTYLPSGRDQWTGNPLAAGGKPGGTRTWTATDG… |
| A0A1M6CMF7 | 410-556 | None |
| A0A1M6KNR8 | 1-119 | None |
| A0A1M6N3N0 | 12-164 | None |
| A0A553JX18 | 318-451 | None |
| A0A553JX66 | 1-116 | None |
| A0A553K654 | 313-481 | None |
| A0A553K048 | 301-458 | None |
| A0A553K1S8 | 8-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.