DPCstruct | MC44606
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1044 |
|---|---|
| Mean domain length (aa) | 148 ± 29 aa |
| Standard deviation of domain lengths | 29.17 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 85.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 16.76 |
| Pfam Score | 98.25 |
| Assigned Pfam label(s) | PF07790- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F7VAI0 | 213-366 | PAGEARVVINEVLANPSEAQGLDANEWIELYNAGTASADLTGWSVKDSTGSPDVLPGSVILAPGAFAIISPGADVGTFWSFPEGTQV… |
| A0A7Y5S315 | 3-148 | ITEYMYQGNGDLYEFIEFTNVGDAAVDMSGWSFDDNSDTPFSVDLSAFGTVAAGESVILTDSDAEDFRTTWGLSPLVKIIGGNTHNL… |
| A0A4R2X0Y0 | 46-232 | None |
| A0A845E2Y0 | 3-149 | None |
| A0A7S1VGC0 | 1-102 | None |
| A0A1N7E0G7 | 12-128 | None |
| A0A3A4ZDL0 | 15-113 | None |
| A0A6J5YKL1 | 336-470 | None |
| H3B531 | 10-260 | None |
| H3BG58 | 2-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.