DPCstruct | MC44604
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 69 ± 9 aa |
| Standard deviation of domain lengths | 9.41 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 44.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W5EGH3 | 9-76 | IVPQALTVEAGLRAGLAQVAYRRAGGTREKLLADFLIGAHAVAEQRPLITRDPRRYRQYFPELKLITP |
| Q07Q00 | 10-70 | IAVWSVAGQTFREYRRSGGIRTSILADFFIGAHAAAVRIPILTRDTARYRNHFPDVELIAP |
| I4HFU4 | 2-50 | None |
| A0A7V5C857 | 45-113 | None |
| A0A2V6YF97 | 6-73 | None |
| A0A7R7HBU9 | 1-63 | None |
| A0A7V8Y472 | 17-87 | None |
| A0A6J4QJR1 | 1-73 | None |
| A0A345IMQ1 | 25-95 | None |
| A0A7W0X9V8 | 20-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.