DPCstruct | MC44601
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 84 ± 5 aa |
| Standard deviation of domain lengths | 4.68 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 26.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U2C017 | 58-138 | FDILVRNSNNKYTVGGGEGSWGGDGIILLEDNIGNLIWFLFMDNIDPIINITIIDDFIEAENANNLIIRVPINTPQDIYIV |
| A0A0Q7SI21 | 1-75 | MVDPWTSINYQGGKIYGGDGQMGNEGYIACTDADDNLVWGIFLDATNPIKQLSIQDTTLTAINEHEDMRIEICLH |
| A0A3L7BK61 | 11-91 | None |
| A0A5B8XY79 | 58-143 | None |
| A0A7H8PII5 | 238-319 | None |
| Q3KEM5 | 106-189 | None |
| A0A062TYR3 | 181-266 | None |
| A0A2W4NZT9 | 1-86 | None |
| A0A7W3T0V9 | 55-137 | None |
| A0A4D4KUN6 | 36-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.