DPCstruct | MC44600
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 303 ± 51 aa |
| Standard deviation of domain lengths | 50.98 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 83.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 17.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q7SBC4 | 20-334 | NIIRQYLHNTGRIQQFQIRSYIENKDFSAITTTQEFEHYIQRQNAFGKVFGNLDMVEDERHYCNFVAGNDAWISKDEAGVYRYFSKA… |
| A0A3D8PRP1 | 63-292 | ENLLQKLLYNLTDKEEDEIFDCEMFDGNQAWIGSDGVKYRYFTRKSSMNIAIGYTIVDIFCALQTELDVYSDYSFWKTRKELVELLN… |
| A0A661VP81 | 151-411 | None |
| E6EVD0 | 42-363 | None |
| A0A6B1TGR5 | 69-434 | None |
| A0A285BGY9 | 271-577 | None |
| W6S2B5 | 39-390 | None |
| A0A1Q8Q2T0 | 5-239 | None |
| A0A1M6TS76 | 71-384 | None |
| A0A7C7DJU8 | 230-517 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.