DPCstruct | MC4460
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 122 ± 17 aa |
| Standard deviation of domain lengths | 17.26 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 29.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W2YBG0 | 2-99 | PRVTAFLREQQVEAGPASERYMVVTQARLPEGAPLQVPDSITFRQLHHIDTQQAAVDAAMTEEQLQRACEYRVVRIKLHGAVVPVQV… |
| W2QUD5 | 15-120 | LPLVVDFLRSRKVSAGPATTLYMATTQARHPSDVPLEVPTSSTFQQLHEAYPTIWIVLHKVEAPIPVNIGDLRRILGLPDWNLRLPF… |
| D0N6I5 | 2-111 | None |
| A0A6G0RPW1 | 1-99 | None |
| A0A6G0RYY6 | 15-145 | None |
| A0A6G0RBD9 | 7-136 | None |
| A0A0W8CJV2 | 26-150 | None |
| A0A6A3RYC7 | 52-187 | None |
| A0A6A3QSR3 | 160-280 | None |
| W2XEL4 | 14-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.