DPCstruct | MC446
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 67 ± 6 aa |
| Standard deviation of domain lengths | 6.35 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 35.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R5E241 | 9-76 | MKQYKVIHIIEPDFGCEGLPDGSVRMDQVILQDGSGVRITVEVADAYLYEQQIDEGDVVIRTEKGICK |
| A0A1Y3SXA3 | 2-69 | QEKYKVIEIFERDYGCEERAEGQTDMVQVRLCSESGKERVIETEDAALYREEITEGTEVFLIDGKLKR |
| A0A1Y3WGQ8 | 2-68 | None |
| A0A1M6JUI3 | 1-58 | None |
| A0A3D4XZC1 | 1-61 | None |
| A0A416PL19 | 2-68 | None |
| A0A3D2I579 | 32-108 | None |
| R7QVC4 | 194-266 | None |
| E0RWU7 | 79-138 | None |
| A0A7G9B6E3 | 4-74 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.