DPCstruct | MC44598
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 113 ± 14 aa |
| Standard deviation of domain lengths | 13.91 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 31.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5S4FDN5 | 3-120 | VTRFQDLPLADRDRAWDGDAADKRVRDWADAEDEPDAAYRDAHIWYDGDKPDNFTSYKLLIADVIDNRLKAVPRAIMAAGAIMQGAR… |
| W5WJI2 | 366-465 | AISDEDWDGSASRFTLEQYRASCLIGPSEASEDKADYKLPVKEPNGDVNRNAVHAAAAALAGGRGGVDASDDEKKAAAKTLIALYGQ… |
| A0A662RR38 | 257-355 | None |
| A0A496ZL23 | 179-283 | None |
| A0A7K3M5P3 | 553-700 | None |
| A0A2J6N694 | 1-96 | None |
| A0A3M0XX44 | 12-114 | None |
| A0A5C7PXN4 | 389-520 | None |
| A0A1G3LRB1 | 4-111 | None |
| A0A1F9VEQ7 | 213-326 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.