DPCstruct | MC44595
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 74 ± 7 aa |
| Standard deviation of domain lengths | 6.67 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 44.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A845G397 | 1-78 | MPRARRIIKLSLPDEFIALCRRDGVAPETVLRGFIADLYGIVNWTSAPRQDGYGSNGSDERDKAQTYYDRVGYPYWNR |
| K2ACG7 | 107-167 | NLTLALPDELLKLCEEVNTTPEAVLQGFIADLCHLVERPYITNGSDERLFAEQYFDRCGYR |
| A0A6M8VP86 | 1-70 | None |
| A0A2S9WZ84 | 143-223 | None |
| A0A2G0Y592 | 151-231 | None |
| A0A849U5V6 | 111-183 | None |
| A0A1G0MCJ0 | 35-99 | None |
| A4TYZ6 | 62-135 | None |
| A0A7U2LCX5 | 209-290 | None |
| A0A5C1M9P4 | 159-232 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.